Lineage for d2e7sk_ (2e7s K:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1968224Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1969505Superfamily h.1.33: Sec2 N-terminal region [144284] (1 family) (S)
    dimeric coiled coil
  5. 1969506Family h.1.33.1: Sec2 N-terminal region [144285] (2 proteins)
  6. 1969517Protein automated matches [254514] (1 species)
    not a true protein
  7. 1969518Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255133] (1 PDB entry)
  8. 1969528Domain d2e7sk_: 2e7s K: [132078]
    Other proteins in same PDB: d2e7sa1
    automated match to d2e7sc_

Details for d2e7sk_

PDB Entry: 2e7s (more details), 3 Å

PDB Description: crystal structure of the yeast sec2p gef domain
PDB Compounds: (K:) Rab guanine nucleotide exchange factor SEC2

SCOPe Domain Sequences for d2e7sk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e7sk_ h.1.33.1 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
leeqlnkslktiasqkaaienynqlkedyntlkrelsdrddevkrlrediakenelrtka
eeeadklnkevedltaslfdeannlvadarmekyaieilnkrlteqlrekdmlldtl

SCOPe Domain Coordinates for d2e7sk_:

Click to download the PDB-style file with coordinates for d2e7sk_.
(The format of our PDB-style files is described here.)

Timeline for d2e7sk_: