SCOPe 2.08: Domain d2e76a1: 2e76 A:13-214

Lineage for d2e76a1 (2e76 A:13-214)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Cytochrome b6 subunit of the cytochrome b6f complex [103498] (2 species)

7. Species Mastigocladus laminosus [TaxId:83541] [103499] (4 PDB entries)

8. Domain d2e76a1: 2e76 A:13-214 [132058]
   Other proteins in same PDB: d2e76b1, d2e76d1, d2e76d2, d2e76e1, d2e76f1, d2e76g1, d2e76h1
   automatically matched to d1vf5a_
   complexed with bcr, cd, cla, fes, hem, opc, sqd, tds, umq

Details for d2e76a1

PDB Entry: 2e76, 3.41 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex with tridecyl-stigmatellin (TDS) from M.laminosus

PDB Compounds: (A:) Cytochrome b6

SCOPe Domain Sequences for d2e76a1:

Sequence; same for both SEQRES and ATOM records:

>d2e76a1 f.21.1.2 (A:13-214) Cytochrome b6 subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
eiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptvteayasvqyi
mnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgvilavitvsfg
vtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltryysahtfvlp
wliavfmllhflmirkqgisgp

Timeline for d2e76a1:

• d2e76a1 first appeared in SCOP 1.73
  
• d2e76a1 appears in SCOPe 2.07