Lineage for d2e76f1 (2e76 F:1-32)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026305Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family) (S)
  5. 3026306Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (2 proteins)
  6. 3026307Protein PetM subunit of the cytochrome b6f complex [103443] (2 species)
  7. 3026310Species Mastigocladus laminosus [TaxId:83541] [103444] (9 PDB entries)
  8. 3026315Domain d2e76f1: 2e76 F:1-32 [132061]
    Other proteins in same PDB: d2e76a1, d2e76b1, d2e76d1, d2e76d2, d2e76e1, d2e76g1, d2e76h1
    automatically matched to d1vf5s_
    complexed with bcr, cd, cla, fes, hem, opc, sqd, tds, umq

Details for d2e76f1

PDB Entry: 2e76 (more details), 3.41 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex with tridecyl-stigmatellin (TDS) from M.laminosus
PDB Compounds: (F:) Cytochrome b6-f complex subunit 7

SCOPe Domain Sequences for d2e76f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e76f1 f.23.25.1 (F:1-32) PetM subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
mteemlyaallsfglifvgwglgvlllkiqga

SCOPe Domain Coordinates for d2e76f1:

Click to download the PDB-style file with coordinates for d2e76f1.
(The format of our PDB-style files is described here.)

Timeline for d2e76f1: