SCOPe 2.08: Domain d2e76d2: 2e76 D:12-45

Lineage for d2e76d2 (2e76 D:12-45)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families)

5. Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)

6. Protein ISP subunit from the cytochrome b6f complex, transmembrane anchor [103428] (2 species)

7. Species Mastigocladus laminosus [TaxId:83541] [103429] (4 PDB entries)

8. Domain d2e76d2: 2e76 D:12-45 [132060]
   Other proteins in same PDB: d2e76a1, d2e76b1, d2e76d1, d2e76e1, d2e76f1, d2e76g1, d2e76h1
   automatically matched to d1vf5d2
   complexed with bcr, cd, cla, fes, hem, opc, sqd, tds, umq

Details for d2e76d2

PDB Entry: 2e76, 3.41 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex with tridecyl-stigmatellin (TDS) from M.laminosus

PDB Compounds: (D:) Cytochrome b6-f complex iron-sulfur subunit

SCOPe Domain Sequences for d2e76d2:

Sequence; same for both SEQRES and ATOM records:

>d2e76d2 f.23.12.1 (D:12-45) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]}
dmgrrqfmnllafgtvtgvalgalyplvkyfipp

Timeline for d2e76d2:

• d2e76d2 first appeared in SCOP 1.73
  
• d2e76d2 appears in SCOPe 2.07