Lineage for d2e2ic1 (2e2i C:3-37,C:173-268)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958148Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2958149Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)
  6. 2958229Protein RPB3 [64315] (2 species)
  7. 2958230Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries)
    Uniprot P16370; part of multichain biological unit
  8. 2958241Domain d2e2ic1: 2e2i C:3-37,C:173-268 [131996]
    Other proteins in same PDB: d2e2ia1, d2e2ib1, d2e2ic2, d2e2ie1, d2e2ie2, d2e2if1, d2e2ih1, d2e2ii1, d2e2ii2, d2e2ij1, d2e2ik1, d2e2il1
    automatically matched to d1i3qc1
    protein/DNA complex; protein/RNA complex; complexed with dgt, mg, zn

Details for d2e2ic1

PDB Entry: 2e2i (more details), 3.41 Å

PDB Description: RNA polymerase II elongation complex in 5 mM Mg+2 with 2'-dGTP
PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOPe Domain Sequences for d2e2ic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e2ic1 d.74.3.1 (C:3-37,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmXaaaiefeydpwnklkhtdywyeqd
sakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlqkkva
sillaltqmdqd

SCOPe Domain Coordinates for d2e2ic1:

Click to download the PDB-style file with coordinates for d2e2ic1.
(The format of our PDB-style files is described here.)

Timeline for d2e2ic1: