SCOPe 2.07: Domain d2dvba_: 2dvb A:

Lineage for d2dvba_ (2dvb A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (30 PDB entries)
   Uniprot P02872 24-255

8. Domain d2dvba_: 2dvb A: [131773]
   automated match to d1bzwa_
   complexed with ca, gal, mn, so4

Details for d2dvba_

PDB Entry: 2dvb, 2.25 Å

PDB Description: crystal structure of peanut lectin gal-beta-1,6-galnac complex

PDB Compounds: (A:) Galactose-binding lectin

SCOPe Domain Sequences for d2dvba_:

Sequence; same for both SEQRES and ATOM records:

>d2dvba_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

Timeline for d2dvba_:

• d2dvba_ first appeared in SCOP 1.73, called d2dvba1
  
• d2dvba_ appears in SCOPe 2.06
  
• d2dvba_ appears in the current release, SCOPe 2.08