Lineage for d2dvba_ (2dvb A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2049734Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2049903Protein Legume lectin [49904] (23 species)
  7. 2050079Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (24 PDB entries)
    Uniprot P02872 24-255
  8. 2050100Domain d2dvba_: 2dvb A: [131773]
    automated match to d1bzwa_
    complexed with ca, gal, mn, so4

Details for d2dvba_

PDB Entry: 2dvb (more details), 2.25 Å

PDB Description: crystal structure of peanut lectin gal-beta-1,6-galnac complex
PDB Compounds: (A:) Galactose-binding lectin

SCOPe Domain Sequences for d2dvba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dvba_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOPe Domain Coordinates for d2dvba_:

Click to download the PDB-style file with coordinates for d2dvba_.
(The format of our PDB-style files is described here.)

Timeline for d2dvba_: