Lineage for d2dvbd_ (2dvb D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2387950Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2388157Protein Legume lectin [49904] (23 species)
  7. 2388337Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (30 PDB entries)
    Uniprot P02872 24-255
  8. 2388381Domain d2dvbd_: 2dvb D: [131776]
    automated match to d1bzwa_
    complexed with ca, gal, mn, so4

Details for d2dvbd_

PDB Entry: 2dvb (more details), 2.25 Å

PDB Description: crystal structure of peanut lectin gal-beta-1,6-galnac complex
PDB Compounds: (D:) Galactose-binding lectin

SCOPe Domain Sequences for d2dvbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dvbd_ b.29.1.1 (D:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOPe Domain Coordinates for d2dvbd_:

Click to download the PDB-style file with coordinates for d2dvbd_.
(The format of our PDB-style files is described here.)

Timeline for d2dvbd_: