Lineage for d2dm5a_ (2dm5 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804418Protein Major urinary protein/alpha-2u-globulin [50832] (2 species)
  7. 2804419Species Mouse (Mus musculus) [TaxId:10090] [50833] (19 PDB entries)
  8. 2804426Domain d2dm5a_: 2dm5 A: [131566]
    automated match to d1df3a_
    complexed with cd, odi

Details for d2dm5a_

PDB Entry: 2dm5 (more details), 1.7 Å

PDB Description: Thermodynamic Penalty Arising From Burial of a Ligand Polar Group Within a Hydrophobic Pocket of a Protein Receptor
PDB Compounds: (A:) major urinary protein

SCOPe Domain Sequences for d2dm5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dm5a_ b.60.1.1 (A:) Major urinary protein/alpha-2u-globulin {Mouse (Mus musculus) [TaxId: 10090]}
eeasstgrnfnvekingewhtiilasdkrekiedngnfrlfleqihvlekslvlkfhtvr
deecselsmvadktekageysvtydgfntftipktdydnflmahlinekdgetfqlmgly
grepdlssdikerfaqlceehgilreniidlsnanrc

SCOPe Domain Coordinates for d2dm5a_:

Click to download the PDB-style file with coordinates for d2dm5a_.
(The format of our PDB-style files is described here.)

Timeline for d2dm5a_: