| Class b: All beta proteins [48724] (176 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.1: Tudor domain [63749] (8 proteins) Pfam PF00567 |
| Protein Lamin-b receptor [141209] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [141210] (1 PDB entry) Uniprot Q14739 1-55 |
| Domain d2diga1: 2dig A:8-62 [131529] |
PDB Entry: 2dig (more details)
SCOPe Domain Sequences for d2diga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2diga1 b.34.9.1 (A:8-62) Lamin-b receptor {Human (Homo sapiens) [TaxId: 9606]}
mpsrkfadgevvrgrwpgsslyyeveilshdstsqlytvkykdgtelelkendik
Timeline for d2diga1: