Lineage for d2diga1 (2dig A:8-62)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665781Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families) (S)
  5. 665782Family b.34.9.1: Tudor domain [63749] (7 proteins)
    Pfam PF00567
  6. 665797Protein Lamin-b receptor [141209] (1 species)
  7. 665798Species Human (Homo sapiens) [TaxId:9606] [141210] (1 PDB entry)
  8. 665799Domain d2diga1: 2dig A:8-62 [131529]

Details for d2diga1

PDB Entry: 2dig (more details)

PDB Description: Solusion structure of the Todor domain of human Lamin-B receptor
PDB Compounds: (A:) Lamin-B receptor

SCOP Domain Sequences for d2diga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2diga1 b.34.9.1 (A:8-62) Lamin-b receptor {Human (Homo sapiens) [TaxId: 9606]}
mpsrkfadgevvrgrwpgsslyyeveilshdstsqlytvkykdgtelelkendik

SCOP Domain Coordinates for d2diga1:

Click to download the PDB-style file with coordinates for d2diga1.
(The format of our PDB-style files is described here.)

Timeline for d2diga1: