Lineage for d2diga1 (2dig A:8-62)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784518Family b.34.9.1: Tudor domain [63749] (9 proteins)
    Pfam PF00567
  6. 2784541Protein Lamin-b receptor [141209] (2 species)
  7. 2784544Species Human (Homo sapiens) [TaxId:9606] [141210] (1 PDB entry)
    Uniprot Q14739 1-55
  8. 2784545Domain d2diga1: 2dig A:8-62 [131529]
    Other proteins in same PDB: d2diga2, d2diga3

Details for d2diga1

PDB Entry: 2dig (more details)

PDB Description: solusion structure of the todor domain of human lamin-b receptor
PDB Compounds: (A:) Lamin-B receptor

SCOPe Domain Sequences for d2diga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2diga1 b.34.9.1 (A:8-62) Lamin-b receptor {Human (Homo sapiens) [TaxId: 9606]}
mpsrkfadgevvrgrwpgsslyyeveilshdstsqlytvkykdgtelelkendik

SCOPe Domain Coordinates for d2diga1:

Click to download the PDB-style file with coordinates for d2diga1.
(The format of our PDB-style files is described here.)

Timeline for d2diga1: