Lineage for d2ddrc_ (2ddr C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988138Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2988139Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2988236Family d.151.1.3: Sphingomyelin phosphodiesterase-like [143902] (2 proteins)
    part of Pfam PF03372
  6. 2988242Protein automated matches [190598] (1 species)
    not a true protein
  7. 2988243Species Bacillus cereus [TaxId:1396] [187614] (4 PDB entries)
  8. 2988245Domain d2ddrc_: 2ddr C: [131400]
    Other proteins in same PDB: d2ddra1
    automated match to d2ddra1
    complexed with ca

Details for d2ddrc_

PDB Entry: 2ddr (more details), 1.4 Å

PDB Description: Crystal structure of sphingomyelinase from Bacillus cereus with calcium ion
PDB Compounds: (C:) Sphingomyelin phosphodiesterase

SCOPe Domain Sequences for d2ddrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ddrc_ d.151.1.3 (C:) automated matches {Bacillus cereus [TaxId: 1396]}
dtlkvmthnvymlstnlypnwgqteradligaadyiknqdvvilnevfdnsasdrllgnl
kkeypnqtavlgrssgsewdktlgnyssstpedggvaivskwpiaekiqyvfakgcgpdn
lsnkgfvytkikkndrfvhvigthlqaedsmcgktspasvrtnqlkeiqdfiknknipnn
eyvliggdmnvnkinaennndseyasmfktlnasvpsytghtatwdattnsiakynfpds
paeyldyiiaskdhanpsyienkvlqpkspqwtvtswfqkytyndysdhypveatism

SCOPe Domain Coordinates for d2ddrc_:

Click to download the PDB-style file with coordinates for d2ddrc_.
(The format of our PDB-style files is described here.)

Timeline for d2ddrc_: