PDB entry 2ddr

View 2ddr on RCSB PDB site
Description: Crystal structure of sphingomyelinase from Bacillus cereus with calcium ion
Class: hydrolase
Keywords: DNase I like folding, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, HYDROLASE
Deposited on 2006-02-02, released 2006-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.213
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sphingomyelin phosphodiesterase
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ddra1
  • Chain 'B':
    Compound: Sphingomyelin phosphodiesterase
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ddrb_
  • Chain 'C':
    Compound: Sphingomyelin phosphodiesterase
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ddrc_
  • Chain 'D':
    Compound: Sphingomyelin phosphodiesterase
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ddrd_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ddrA (A:)
    evsttqndtlkvmthnvymlstnlypnwgqteradligaadyiknqdvvilnevfdnsas
    drllgnlkkeypnqtavlgrssgsewdktlgnyssstpedggvaivskwpiaekiqyvfa
    kgcgpdnlsnkgfvytkikkndrfvhvigthlqaedsmcgktspasvrtnqlkeiqdfik
    nknipnneyvliggdmnvnkinaennndseyasmfktlnasvpsytghtatwdattnsia
    kynfpdspaeyldyiiaskdhanpsyienkvlqpkspqwtvtswfqkytyndysdhypve
    atismk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ddrA (A:)
    ndtlkvmthnvymlstnlypnwgqteradligaadyiknqdvvilnevfdnsasdrllgn
    lkkeypnqtavlgrssgsewdktlgnyssstpedggvaivskwpiaekiqyvfakgclsn
    kgfvytkikkndrfvhvigthlqaespasvrtnqlkeiqdfiknknipnneyvliggdmn
    vnkinaennndseyasmfktlnasvpsytghtatwdattnsiakynfpdspaeyldyiia
    skdhanpsyienkvlqpkspqwtvtswfqkytyndysdhypveatism
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ddrB (B:)
    evsttqndtlkvmthnvymlstnlypnwgqteradligaadyiknqdvvilnevfdnsas
    drllgnlkkeypnqtavlgrssgsewdktlgnyssstpedggvaivskwpiaekiqyvfa
    kgcgpdnlsnkgfvytkikkndrfvhvigthlqaedsmcgktspasvrtnqlkeiqdfik
    nknipnneyvliggdmnvnkinaennndseyasmfktlnasvpsytghtatwdattnsia
    kynfpdspaeyldyiiaskdhanpsyienkvlqpkspqwtvtswfqkytyndysdhypve
    atismk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ddrB (B:)
    ndtlkvmthnvymlstnlypnwgqteradligaadyiknqdvvilnevfdnsasdrllgn
    lkkeypnqtavlgrssgsewdktlgnyssstpedggvaivskwpiaekiqyvfakgcnls
    nkgfvytkikkndrfvhvigthlqaespasvrtnqlkeiqdfiknknipnneyvliggdm
    nvnkinaennndseyasmfktlnasvpsytghtatwdattnsiakynfpdspaeyldyii
    askdhanpsyienkvlqpkspqwtvtswfqkytyndysdhypveatism
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ddrC (C:)
    evsttqndtlkvmthnvymlstnlypnwgqteradligaadyiknqdvvilnevfdnsas
    drllgnlkkeypnqtavlgrssgsewdktlgnyssstpedggvaivskwpiaekiqyvfa
    kgcgpdnlsnkgfvytkikkndrfvhvigthlqaedsmcgktspasvrtnqlkeiqdfik
    nknipnneyvliggdmnvnkinaennndseyasmfktlnasvpsytghtatwdattnsia
    kynfpdspaeyldyiiaskdhanpsyienkvlqpkspqwtvtswfqkytyndysdhypve
    atismk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ddrC (C:)
    dtlkvmthnvymlstnlypnwgqteradligaadyiknqdvvilnevfdnsasdrllgnl
    kkeypnqtavlgrssgsewdktlgnyssstpedggvaivskwpiaekiqyvfakgcgpdn
    lsnkgfvytkikkndrfvhvigthlqaedsmcgktspasvrtnqlkeiqdfiknknipnn
    eyvliggdmnvnkinaennndseyasmfktlnasvpsytghtatwdattnsiakynfpds
    paeyldyiiaskdhanpsyienkvlqpkspqwtvtswfqkytyndysdhypveatism
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ddrD (D:)
    evsttqndtlkvmthnvymlstnlypnwgqteradligaadyiknqdvvilnevfdnsas
    drllgnlkkeypnqtavlgrssgsewdktlgnyssstpedggvaivskwpiaekiqyvfa
    kgcgpdnlsnkgfvytkikkndrfvhvigthlqaedsmcgktspasvrtnqlkeiqdfik
    nknipnneyvliggdmnvnkinaennndseyasmfktlnasvpsytghtatwdattnsia
    kynfpdspaeyldyiiaskdhanpsyienkvlqpkspqwtvtswfqkytyndysdhypve
    atismk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ddrD (D:)
    dtlkvmthnvymlstnlypnwgqteradligaadyiknqdvvilnevfdnsasdrllgnl
    kkeypnqtavlgrssgsewdktlgnyssstpedggvaivskwpiaekiqyvfakgcgpdn
    lsnkgfvytkikkndrfvhvigthlqaedsmcgktspasvrtnqlkeiqdfiknknipnn
    eyvliggdmnvnkinaennndseyasmfktlnasvpsytghtatwdattnsiakynfpds
    paeyldyiiaskdhanpsyienkvlqpkspqwtvtswfqkytyndysdhypveatism