Lineage for d2ddrb_ (2ddr B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548549Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2548550Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2548643Family d.151.1.3: Sphingomyelin phosphodiesterase-like [143902] (2 proteins)
    part of Pfam PF03372
  6. 2548649Protein automated matches [190598] (1 species)
    not a true protein
  7. 2548650Species Bacillus cereus [TaxId:1396] [187614] (4 PDB entries)
  8. 2548651Domain d2ddrb_: 2ddr B: [131399]
    Other proteins in same PDB: d2ddra1
    automated match to d2ddra1
    complexed with ca

Details for d2ddrb_

PDB Entry: 2ddr (more details), 1.4 Å

PDB Description: Crystal structure of sphingomyelinase from Bacillus cereus with calcium ion
PDB Compounds: (B:) Sphingomyelin phosphodiesterase

SCOPe Domain Sequences for d2ddrb_:

Sequence, based on SEQRES records: (download)

>d2ddrb_ d.151.1.3 (B:) automated matches {Bacillus cereus [TaxId: 1396]}
ndtlkvmthnvymlstnlypnwgqteradligaadyiknqdvvilnevfdnsasdrllgn
lkkeypnqtavlgrssgsewdktlgnyssstpedggvaivskwpiaekiqyvfakgcgpd
nlsnkgfvytkikkndrfvhvigthlqaedsmcgktspasvrtnqlkeiqdfiknknipn
neyvliggdmnvnkinaennndseyasmfktlnasvpsytghtatwdattnsiakynfpd
spaeyldyiiaskdhanpsyienkvlqpkspqwtvtswfqkytyndysdhypveatism

Sequence, based on observed residues (ATOM records): (download)

>d2ddrb_ d.151.1.3 (B:) automated matches {Bacillus cereus [TaxId: 1396]}
ndtlkvmthnvymlstnlypnwgqteradligaadyiknqdvvilnevfdnsasdrllgn
lkkeypnqtavlgrssgsewdktlgnyssstpedggvaivskwpiaekiqyvfakgcnls
nkgfvytkikkndrfvhvigthlqaespasvrtnqlkeiqdfiknknipnneyvliggdm
nvnkinaennndseyasmfktlnasvpsytghtatwdattnsiakynfpdspaeyldyii
askdhanpsyienkvlqpkspqwtvtswfqkytyndysdhypveatism

SCOPe Domain Coordinates for d2ddrb_:

Click to download the PDB-style file with coordinates for d2ddrb_.
(The format of our PDB-style files is described here.)

Timeline for d2ddrb_: