SCOPe 2.04: Domain d2dcyd_: 2dcy D:

Lineage for d2dcyd_ (2dcy D:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (18 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus subtilis [TaxId:1423] [49981] (3 PDB entries)

8. Domain d2dcyd_: 2dcy D: [131391]
   automated match to d2dcya1
   complexed with dio, tar

Details for d2dcyd_

PDB Entry: 2dcy, 1.4 Å

PDB Description: crystal structure of bacillus subtilis family-11 xylanase

PDB Compounds: (D:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d2dcyd_:

Sequence; same for both SEQRES and ATOM records:

>d2dcyd_ b.29.1.11 (D:) Xylanase II {Bacillus subtilis [TaxId: 1423]}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

Timeline for d2dcyd_:

• d2dcyd_ first appeared in SCOP 1.73, called d2dcyd1
  
• d2dcyd_ appears in SCOPe 2.03
  
• d2dcyd_ appears in SCOPe 2.05
  
• d2dcyd_ appears in the current release, SCOPe 2.08