Lineage for d2dcyd1 (2dcy D:1-185)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 664069Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 664114Protein Xylanase II [49979] (16 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 664146Species Bacillus subtilis [TaxId:1423] [49981] (3 PDB entries)
  8. 664150Domain d2dcyd1: 2dcy D:1-185 [131391]
    automatically matched to d1axka2
    complexed with dio, tar

Details for d2dcyd1

PDB Entry: 2dcy (more details), 1.4 Å

PDB Description: crystal structure of bacillus subtilis family-11 xylanase
PDB Compounds: (D:) Endo-1,4-beta-xylanase A

SCOP Domain Sequences for d2dcyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dcyd1 b.29.1.11 (D:1-185) Xylanase II {Bacillus subtilis [TaxId: 1423]}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

SCOP Domain Coordinates for d2dcyd1:

Click to download the PDB-style file with coordinates for d2dcyd1.
(The format of our PDB-style files is described here.)

Timeline for d2dcyd1: