Lineage for d2dcyd_ (2dcy D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780100Protein Xylanase II [49979] (21 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2780156Species Bacillus subtilis [TaxId:1423] [49981] (3 PDB entries)
  8. 2780160Domain d2dcyd_: 2dcy D: [131391]
    automated match to d2dcya1
    complexed with dio, tar, tla

Details for d2dcyd_

PDB Entry: 2dcy (more details), 1.4 Å

PDB Description: crystal structure of bacillus subtilis family-11 xylanase
PDB Compounds: (D:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d2dcyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dcyd_ b.29.1.11 (D:) Xylanase II {Bacillus subtilis [TaxId: 1423]}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

SCOPe Domain Coordinates for d2dcyd_:

Click to download the PDB-style file with coordinates for d2dcyd_.
(The format of our PDB-style files is described here.)

Timeline for d2dcyd_: