Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Myosin-binding protein C, slow-type [141013] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141014] (2 PDB entries) Uniprot Q00872 342-431! Uniprot Q00872 58-170 |
Domain d2dava1: 2dav A:8-120 [131357] Other proteins in same PDB: d2dava2, d2dava3 1st Iset domain |
PDB Entry: 2dav (more details)
SCOPe Domain Sequences for d2dava1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} ilfiekpqggtvkvgeditfiakvkaedllrkptikwfkgkwmdlaskagkhlqlketfe rhsrvytfemqiikakdnfagnyrcevtykdkfdscsfdlevhestgttpnid
Timeline for d2dava1: