Lineage for d2dava1 (2dav A:8-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753857Protein Myosin-binding protein C, slow-type [141013] (1 species)
  7. 2753858Species Human (Homo sapiens) [TaxId:9606] [141014] (2 PDB entries)
    Uniprot Q00872 342-431! Uniprot Q00872 58-170
  8. 2753860Domain d2dava1: 2dav A:8-120 [131357]
    Other proteins in same PDB: d2dava2, d2dava3
    1st Iset domain

Details for d2dava1

PDB Entry: 2dav (more details)

PDB Description: solution structure of the first ig-like domain of myosin-binding protein c, slow-type
PDB Compounds: (A:) Myosin-binding protein C, slow-type

SCOPe Domain Sequences for d2dava1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]}
ilfiekpqggtvkvgeditfiakvkaedllrkptikwfkgkwmdlaskagkhlqlketfe
rhsrvytfemqiikakdnfagnyrcevtykdkfdscsfdlevhestgttpnid

SCOPe Domain Coordinates for d2dava1:

Click to download the PDB-style file with coordinates for d2dava1.
(The format of our PDB-style files is described here.)

Timeline for d2dava1: