Lineage for d2d8ca1 (2d8c A:7-91)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1493398Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1493442Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 1493503Protein Sphingomyelin synthase 1, SMS1 [140622] (1 species)
    Phosphatidylcholine:ceramide cholinephosphotransferase 1
  7. 1493504Species Mouse (Mus musculus) [TaxId:10090] [140623] (1 PDB entry)
    Uniprot Q8VCQ6 1-84
  8. 1493505Domain d2d8ca1: 2d8c A:7-91 [131328]

Details for d2d8ca1

PDB Entry: 2d8c (more details)

PDB Description: solution structure of the sam-domain of mouse phosphatidyl ceramidecholinephosphotransferase 1
PDB Compounds: (A:) Phosphatidylcholine:ceramide cholinephosphotransferase 1

SCOPe Domain Sequences for d2d8ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d8ca1 a.60.1.2 (A:7-91) Sphingomyelin synthase 1, SMS1 {Mouse (Mus musculus) [TaxId: 10090]}
gmlsartmkevvywspkkvadwllenampeyceplehftgqdlinltqedfkkpplyrvs
sdngqrlldmietlkmehhmeahkn

SCOPe Domain Coordinates for d2d8ca1:

Click to download the PDB-style file with coordinates for d2d8ca1.
(The format of our PDB-style files is described here.)

Timeline for d2d8ca1: