SCOP 1.73: Domain d2d8ca1: 2d8c A:7-91

Lineage for d2d8ca1 (2d8c A:7-91)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.60: SAM domain-like [47768] (15 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (2 families)

5. Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (15 proteins)

6. Protein Sphingomyelin synthase 1, SMS1 [140622] (1 species)
   Phosphatidylcholine:ceramide cholinephosphotransferase 1

7. Species Mouse (Mus musculus) [TaxId:10090] [140623] (1 PDB entry)

8. Domain d2d8ca1: 2d8c A:7-91 [131328]

Details for d2d8ca1

PDB Entry: 2d8c

PDB Description: solution structure of the sam-domain of mouse phosphatidyl ceramidecholinephosphotransferase 1

PDB Compounds: (A:) Phosphatidylcholine:ceramide cholinephosphotransferase 1

SCOP Domain Sequences for d2d8ca1:

Sequence; same for both SEQRES and ATOM records:

>d2d8ca1 a.60.1.2 (A:7-91) Sphingomyelin synthase 1, SMS1 {Mouse (Mus musculus) [TaxId: 10090]}
gmlsartmkevvywspkkvadwllenampeyceplehftgqdlinltqedfkkpplyrvs
sdngqrlldmietlkmehhmeahkn

Timeline for d2d8ca1:

• d2d8ca1 is new in SCOP 1.73
  
• d2d8ca1 appears in SCOP 1.75
  
• d2d8ca1 appears in the current release, SCOPe 2.08