![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
![]() | Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins) |
![]() | Protein Sphingomyelin synthase 1, SMS1 [140622] (1 species) Phosphatidylcholine:ceramide cholinephosphotransferase 1 |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [140623] (1 PDB entry) Uniprot Q8VCQ6 1-84 |
![]() | Domain d2d8ca1: 2d8c A:8-91 [131328] Other proteins in same PDB: d2d8ca2, d2d8ca3 |
PDB Entry: 2d8c (more details)
SCOPe Domain Sequences for d2d8ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d8ca1 a.60.1.2 (A:8-91) Sphingomyelin synthase 1, SMS1 {Mouse (Mus musculus) [TaxId: 10090]} mlsartmkevvywspkkvadwllenampeyceplehftgqdlinltqedfkkpplyrvss dngqrlldmietlkmehhmeahkn
Timeline for d2d8ca1: