SCOPe 2.08: Domain d2d0fa1: 2d0f A:1-122

Lineage for d2d0fa1 (2d0f A:1-122)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Thermoactinomyces vulgaris [TaxId:2026] [254919] (8 PDB entries)

8. Domain d2d0fa1: 2d0f A:1-122 [131064]
   Other proteins in same PDB: d2d0fa2, d2d0fa3
   automated match to d1ji1a1
   complexed with ca, mpd; mutant

Details for d2d0fa1

PDB Entry: 2d0f, 2.08 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase 1 (tvai) mutant d356n complexed with p2, a pullulan model oligosaccharide

PDB Compounds: (A:) alpha-amylase I

SCOPe Domain Sequences for d2d0fa1:

Sequence; same for both SEQRES and ATOM records:

>d2d0fa1 b.1.18.0 (A:1-122) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
aandnnvewnglfhdqgplfdnapeptstqsvtlklrtfkgditsanikywdtadnafhw
vpmvwdsndptgtfdywkgtipaspsikyyrfqindgtstawyngngpsstepnaddfyi
ip

Timeline for d2d0fa1:

• d2d0fa1 first appeared in SCOP 1.73
  
• d2d0fa1 appears in SCOPe 2.07