Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (41 species) not a true protein |
Species Thermoactinomyces vulgaris [TaxId:2026] [254921] (8 PDB entries) |
Domain d2d0fa2: 2d0f A:555-637 [131065] Other proteins in same PDB: d2d0fa1, d2d0fa3 automated match to d1ji1a2 complexed with ca, mpd; mutant |
PDB Entry: 2d0f (more details), 2.08 Å
SCOPe Domain Sequences for d2d0fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d0fa2 b.71.1.0 (A:555-637) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]} sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh sytvqngmvtvavdghygavlaq
Timeline for d2d0fa2: