SCOPe 2.08: Domain d2czvb_: 2czv B:

Lineage for d2czvb_ (2czv B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.3: PHP domain-like [89550] (3 families)

5. Family c.6.3.2: RNase P subunit p30 [110442] (1 protein)
   Pfam PF01876

6. Protein Ribonuclease P protein component 3, Rnp3 [110443] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [110444] (2 PDB entries)
   Uniprot O59543 # PH1877

8. Domain d2czvb_: 2czv B: [131057]
   Other proteins in same PDB: d2czvc1, d2czvd_
   automated match to d1v77a_
   protein/RNA complex; complexed with acy, bog

Details for d2czvb_

PDB Entry: 2czv, 2 Å

PDB Description: crystal structure of archeal rnase p protein ph1481p in complex with ph1877p

PDB Compounds: (B:) Ribonuclease P protein component 3

SCOPe Domain Sequences for d2czvb_:

Sequence; same for both SEQRES and ATOM records:

>d2czvb_ c.6.3.2 (B:) Ribonuclease P protein component 3, Rnp3 {Pyrococcus horikoshii [TaxId: 53953]}
gvkfiemdirdkeayelakewfdevvvsikfneevdkeklrearkeygkvaillsnpkps
lvrdtvqkfksyliyvesndlrvirysiekgvdaiispwvnrkdpgidhvlaklmvkknv
algfslrpllysnpyeranllrfmmkawklvekykvrrfltssaqekwdvryprdlislg
vvigmeipqakasismypeiilkrlk

Timeline for d2czvb_:

• d2czvb_ first appeared in SCOP 1.73, called d2czvb1
  
• d2czvb_ appears in SCOPe 2.07