PDB entry 2czv

View 2czv on RCSB PDB site
Description: Crystal structure of archeal RNase P protein ph1481p in complex with ph1877p
Class: hydrolase
Keywords: Ribonuclease, RNA binding protein, RNA recognition motif, Protein-protein complex, Hydrolase
Deposited on 2005-07-19, released 2006-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease P protein component 3
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1877
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2czva_
  • Chain 'B':
    Compound: Ribonuclease P protein component 3
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1877
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2czvb_
  • Chain 'C':
    Compound: Ribonuclease P protein component 2
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1481
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59150 (Start-119)
      • engineered (71)
    Domains in SCOPe 2.08: d2czvc1
  • Chain 'D':
    Compound: Ribonuclease P protein component 2
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1481
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59150 (Start-119)
      • engineered (71)
    Domains in SCOPe 2.08: d2czvd_
  • Heterogens: BOG, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2czvA (A:)
    mvggggvkfiemdirdkeayelakewfdevvvsikfneevdkeklrearkeygkvaills
    npkpslvrdtvqkfksyliyvesndlrvirysiekgvdaiispwvnrkdpgidhvlaklm
    vkknvalgfslrpllysnpyeranllrfmmkawklvekykvrrfltssaqekwdvryprd
    lislgvvigmeipqakasismypeiilkrlky
    

    Sequence, based on observed residues (ATOM records): (download)
    >2czvA (A:)
    vggggvkfiemdirdkeayelakewfdevvvsikfneevdkeklrearkeygkvaillsn
    pkpslvrdtvqkfksyliyvesndlrvirysiekgvdaiispwvnrkdpgidhvlaklmv
    kknvalgfslrpllysnpyeranllrfmmkawklvekykvrrfltssaqekwdvryprdl
    islgvvigmeipqakasismypeiilkr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2czvB (B:)
    mvggggvkfiemdirdkeayelakewfdevvvsikfneevdkeklrearkeygkvaills
    npkpslvrdtvqkfksyliyvesndlrvirysiekgvdaiispwvnrkdpgidhvlaklm
    vkknvalgfslrpllysnpyeranllrfmmkawklvekykvrrfltssaqekwdvryprd
    lislgvvigmeipqakasismypeiilkrlky
    

    Sequence, based on observed residues (ATOM records): (download)
    >2czvB (B:)
    gvkfiemdirdkeayelakewfdevvvsikfneevdkeklrearkeygkvaillsnpkps
    lvrdtvqkfksyliyvesndlrvirysiekgvdaiispwvnrkdpgidhvlaklmvkknv
    algfslrpllysnpyeranllrfmmkawklvekykvrrfltssaqekwdvryprdlislg
    vvigmeipqakasismypeiilkrlk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2czvC (C:)
    mmrklktlpptlrdknryiafeiisdgdftkdevkeliwksslevlgetgtaivkpwlik
    fdpntktgivrsdreyveylrfalmlvsefngkrliirtlgvsgtikrlkrkflakygwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2czvC (C:)
    rklktlpptlrdknryiafeiisdgdftkdevkeliwksslevlgetgtaivkpwlikfd
    pntktgivrsdreyveylrfalmlvsefngkrliirtlgvsgtikrlkrkflakygwk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2czvD (D:)
    mmrklktlpptlrdknryiafeiisdgdftkdevkeliwksslevlgetgtaivkpwlik
    fdpntktgivrsdreyveylrfalmlvsefngkrliirtlgvsgtikrlkrkflakygwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2czvD (D:)
    mrklktlpptlrdknryiafeiisdgdftkdevkeliwksslevlgetgtaivkpwlikf
    dpntktgivrsdreyveylrfalmlvsefngkrliirtlgvsgtikrlkrkflakygwk