![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies) variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands |
![]() | Superfamily c.6.3: PHP domain-like [89550] (3 families) ![]() |
![]() | Family c.6.3.2: RNase P subunit p30 [110442] (1 protein) Pfam PF01876 |
![]() | Protein Ribonuclease P protein component 3, Rnp3 [110443] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [110444] (2 PDB entries) Uniprot O59543 # PH1877 |
![]() | Domain d2czva_: 2czv A: [131056] Other proteins in same PDB: d2czvc1, d2czvd_ automated match to d1v77a_ protein/RNA complex; complexed with acy, bog |
PDB Entry: 2czv (more details), 2 Å
SCOPe Domain Sequences for d2czva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2czva_ c.6.3.2 (A:) Ribonuclease P protein component 3, Rnp3 {Pyrococcus horikoshii [TaxId: 53953]} vggggvkfiemdirdkeayelakewfdevvvsikfneevdkeklrearkeygkvaillsn pkpslvrdtvqkfksyliyvesndlrvirysiekgvdaiispwvnrkdpgidhvlaklmv kknvalgfslrpllysnpyeranllrfmmkawklvekykvrrfltssaqekwdvryprdl islgvvigmeipqakasismypeiilkr
Timeline for d2czva_: