Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.59: Rnp2-like [160350] (1 family) contains extra C-terminal helix automatically mapped to Pfam PF01900 |
Family d.58.59.1: Rpp14/Pop5-like [160351] (2 proteins) Pfam PF01900 |
Protein RNase P protein component 2, Rnp2 [160352] (2 species) |
Species Pyrococcus horikoshii [TaxId:53953] [160353] (1 PDB entry) Uniprot O59150 3-120 |
Domain d2czvc1: 2czv C:3-120 [145059] Other proteins in same PDB: d2czva_, d2czvb_ protein/RNA complex; complexed with acy, bog |
PDB Entry: 2czv (more details), 2 Å
SCOPe Domain Sequences for d2czvc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2czvc1 d.58.59.1 (C:3-120) RNase P protein component 2, Rnp2 {Pyrococcus horikoshii [TaxId: 53953]} rklktlpptlrdknryiafeiisdgdftkdevkeliwksslevlgetgtaivkpwlikfd pntktgivrsdreyveylrfalmlvsefngkrliirtlgvsgtikrlkrkflakygwk
Timeline for d2czvc1: