Lineage for d2cz1a_ (2cz1 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1222382Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 1222383Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. 1222384Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
  6. 1222403Protein automated matches [190256] (4 species)
    not a true protein
  7. 1222410Species Rhodococcus erythropolis [TaxId:1833] [187042] (17 PDB entries)
  8. 1222414Domain d2cz1a_: 2cz1 A: [131033]
    Other proteins in same PDB: d2cz1b_
    automated match to d2ahja_
    complexed with bua, fe, mg

Details for d2cz1a_

PDB Entry: 2cz1 (more details), 1.39 Å

PDB Description: photo-activation state of Fe-type NHase with n-BA in anaerobic condition
PDB Compounds: (A:) Nitrile hydratase subunit alpha

SCOPe Domain Sequences for d2cz1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cz1a_ d.149.1.1 (A:) automated matches {Rhodococcus erythropolis [TaxId: 1833]}
enaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
ivtkdcligvaipqvp

SCOPe Domain Coordinates for d2cz1a_:

Click to download the PDB-style file with coordinates for d2cz1a_.
(The format of our PDB-style files is described here.)

Timeline for d2cz1a_: