Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily) 4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets |
Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) duplication: contains two structural repeats |
Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins) |
Protein automated matches [190256] (4 species) not a true protein |
Species Rhodococcus erythropolis [TaxId:1833] [187042] (17 PDB entries) |
Domain d2cz1a_: 2cz1 A: [131033] Other proteins in same PDB: d2cz1b_ automated match to d2ahja_ complexed with bua, fe, mg |
PDB Entry: 2cz1 (more details), 1.39 Å
SCOPe Domain Sequences for d2cz1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cz1a_ d.149.1.1 (A:) automated matches {Rhodococcus erythropolis [TaxId: 1833]} enaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe ivtkdcligvaipqvp
Timeline for d2cz1a_: