SCOPe 2.01: Domain d2cz1a_: 2cz1 A:

Lineage for d2cz1a_ (2cz1 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
   4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets

4. Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (1 family)
   duplication: contains two structural repeats

5. Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)

6. Protein automated matches [190256] (4 species)
   not a true protein

7. Species Rhodococcus erythropolis [TaxId:1833] [187042] (17 PDB entries)

8. Domain d2cz1a_: 2cz1 A: [131033]
   Other proteins in same PDB: d2cz1b_
   automated match to d2ahja_
   complexed with bua, fe, mg

Details for d2cz1a_

PDB Entry: 2cz1, 1.39 Å

PDB Description: photo-activation state of Fe-type NHase with n-BA in anaerobic condition

PDB Compounds: (A:) Nitrile hydratase subunit alpha

SCOPe Domain Sequences for d2cz1a_:

Sequence; same for both SEQRES and ATOM records:

>d2cz1a_ d.149.1.1 (A:) automated matches {Rhodococcus erythropolis [TaxId: 1833]}
enaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
ivtkdcligvaipqvp

Timeline for d2cz1a_:

• d2cz1a_ first appeared in SCOP 1.73, called d2cz1a1
  
• d2cz1a_ was called d2cz1a1 in SCOP 1.75
  
• d2cz1a_ appears in SCOPe 2.02
  
• d2cz1a_ appears in the current release, SCOPe 2.08