SCOP 1.73: Domain d2cz1a1: 2cz1 A:9-203

Lineage for d2cz1a1 (2cz1 A:9-203)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
   4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets

4. Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (1 family)
   duplication: contains two structural repeats

5. Family d.149.1.1: Nitrile hydratase alpha chain [56210] (2 proteins)

6. Protein Iron-containing nitrile hydratase [56211] (1 species)

7. Species Rhodococcus erythropolis [TaxId:1833] [56212] (7 PDB entries)
   also Rhodococcus sp. R312

8. Domain d2cz1a1: 2cz1 A:9-203 [131033]
   Other proteins in same PDB: d2cz1b1
   automatically matched to d2ahja_
   complexed with bua, fe, mg

Details for d2cz1a1

PDB Entry: 2cz1, 1.39 Å

PDB Description: photo-activation state of Fe-type NHase with n-BA in anaerobic condition

PDB Compounds: (A:) Nitrile hydratase subunit alpha

SCOP Domain Sequences for d2cz1a1:

Sequence; same for both SEQRES and ATOM records:

>d2cz1a1 d.149.1.1 (A:9-203) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
enaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
ivtkdcligvaipqv

Timeline for d2cz1a1:

• d2cz1a1 is new in SCOP 1.73
  
• d2cz1a1 appears in SCOP 1.75
  
• d2cz1a1 appears in the current release, SCOPe 2.08, called d2cz1a_