Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) |
Family d.38.1.1: 4HBT-like [54638] (16 proteins) Pfam PF03061 |
Protein Probable thioesterase TTHA1846 [143150] (1 species) |
Species Thermus thermophilus [TaxId:274] [143151] (1 PDB entry) |
Domain d2cyeb1: 2cye B:1-132 [131022] automatically matched to 2CYE A:1-132 complexed with coa, zn |
PDB Entry: 2cye (more details), 1.9 Å
SCOP Domain Sequences for d2cyeb1:
Sequence, based on SEQRES records: (download)
>d2cyeb1 d.38.1.1 (B:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} megfpvrvrvdvrfrdldplghvnnavflsymelariryfqrispdwleeghfvvarmev dylrpillgdevfvgvrtvglgrsslrmehlvtangesaakglgvlvwleggrpaplpea ireriralegrp
>d2cyeb1 d.38.1.1 (B:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]} megfpvrvrvdvrfrdldplghvnnavflsymelariryfqridwleeghfvvarmevdy lrpillgdevfvgvrtvglgrsslrmehlvtangesaakglgvlvwleggrpaplpeair eriralegrp
Timeline for d2cyeb1: