Lineage for d2cyed1 (2cye D:3-127)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721376Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 721377Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 721378Family d.38.1.1: 4HBT-like [54638] (16 proteins)
    Pfam PF03061
  6. 721461Protein Probable thioesterase TTHA1846 [143150] (1 species)
  7. 721462Species Thermus thermophilus [TaxId:274] [143151] (1 PDB entry)
  8. 721466Domain d2cyed1: 2cye D:3-127 [131024]
    automatically matched to 2CYE A:1-132
    complexed with coa, zn

Details for d2cyed1

PDB Entry: 2cye (more details), 1.9 Å

PDB Description: Crystal structure of Thioesterase complexed with coenzyme A and Zn from Thermus thermophilus HB8
PDB Compounds: (D:) conserved hypothetical protein, TTHA1846

SCOP Domain Sequences for d2cyed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cyed1 d.38.1.1 (D:3-127) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]}
gfpvrvrvdvrfrdldplghvnnavflsymelariryfqrispdwleeghfvvarmevdy
lrpillgdevfvgvrtvglgrsslrmehlvtangesaakglgvlvwleggrpaplpeair
erira

SCOP Domain Coordinates for d2cyed1:

Click to download the PDB-style file with coordinates for d2cyed1.
(The format of our PDB-style files is described here.)

Timeline for d2cyed1: