SCOP 1.73: Domain d2cyec1: 2cye C:1-132

Lineage for d2cyec1 (2cye C:1-132)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families)

5. Family d.38.1.1: 4HBT-like [54638] (16 proteins)
   Pfam PF03061

6. Protein Probable thioesterase TTHA1846 [143150] (1 species)

7. Species Thermus thermophilus [TaxId:274] [143151] (1 PDB entry)

8. Domain d2cyec1: 2cye C:1-132 [131023]
   automatically matched to 2CYE A:1-132
   complexed with coa, zn

Details for d2cyec1

PDB Entry: 2cye, 1.9 Å

PDB Description: Crystal structure of Thioesterase complexed with coenzyme A and Zn from Thermus thermophilus HB8

PDB Compounds: (C:) conserved hypothetical protein, TTHA1846

SCOP Domain Sequences for d2cyec1:

Sequence; same for both SEQRES and ATOM records:

>d2cyec1 d.38.1.1 (C:1-132) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]}
megfpvrvrvdvrfrdldplghvnnavflsymelariryfqrispdwleeghfvvarmev
dylrpillgdevfvgvrtvglgrsslrmehlvtangesaakglgvlvwleggrpaplpea
ireriralegrp

Timeline for d2cyec1:

• d2cyec1 is new in SCOP 1.73
  
• d2cyec1 appears in SCOP 1.75
  
• d2cyec1 appears in the current release, SCOPe 2.08, called d2cyec_