Lineage for d2cyeb_ (2cye B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943540Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2943637Protein Probable thioesterase TTHA1846 [143150] (1 species)
  7. 2943638Species Thermus thermophilus [TaxId:274] [143151] (1 PDB entry)
    Uniprot Q5SH84 1-132
  8. 2943640Domain d2cyeb_: 2cye B: [131022]
    automated match to d2cyea1
    complexed with coa, zn

Details for d2cyeb_

PDB Entry: 2cye (more details), 1.9 Å

PDB Description: Crystal structure of Thioesterase complexed with coenzyme A and Zn from Thermus thermophilus HB8
PDB Compounds: (B:) Putative thioesterase

SCOPe Domain Sequences for d2cyeb_:

Sequence, based on SEQRES records: (download)

>d2cyeb_ d.38.1.1 (B:) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]}
megfpvrvrvdvrfrdldplghvnnavflsymelariryfqrispdwleeghfvvarmev
dylrpillgdevfvgvrtvglgrsslrmehlvtangesaakglgvlvwleggrpaplpea
ireriralegrp

Sequence, based on observed residues (ATOM records): (download)

>d2cyeb_ d.38.1.1 (B:) Probable thioesterase TTHA1846 {Thermus thermophilus [TaxId: 274]}
megfpvrvrvdvrfrdldplghvnnavflsymelariryfqridwleeghfvvarmevdy
lrpillgdevfvgvrtvglgrsslrmehlvtangesaakglgvlvwleggrpaplpeair
eriralegrp

SCOPe Domain Coordinates for d2cyeb_:

Click to download the PDB-style file with coordinates for d2cyeb_.
(The format of our PDB-style files is described here.)

Timeline for d2cyeb_: