SCOPe 2.06: Domain d2cxea2: 2cxe A:9-132

Lineage for d2cxea2 (2cxe A:9-132)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (18 species)
   not a true protein

7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [255097] (1 PDB entry)

8. Domain d2cxea2: 2cxe A:9-132 [130997]
   Other proteins in same PDB: d2cxea1, d2cxeb1, d2cxec1, d2cxed1
   automated match to d1ej7l2

Details for d2cxea2

PDB Entry: 2cxe, 3 Å

PDB Description: Crystal structure of octameric ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) from Pyrococcus horikoshii OT3 (form-2 crystal)

PDB Compounds: (A:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d2cxea2:

Sequence; same for both SEQRES and ATOM records:

>d2cxea2 d.58.9.0 (A:9-132) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
ewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwklpemakrs
makvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppye
ylrh

Timeline for d2cxea2:

• d2cxea2 first appeared in SCOP 1.73
  
• d2cxea2 appears in SCOPe 2.05
  
• d2cxea2 appears in SCOPe 2.07
  
• d2cxea2 appears in the current release, SCOPe 2.08