Lineage for d2cxea2 (2cxe A:9-132)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2559642Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2559863Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2559864Protein automated matches [226983] (27 species)
    not a true protein
  7. 2560008Species Pyrococcus horikoshii OT3 [TaxId:70601] [255097] (1 PDB entry)
  8. 2560009Domain d2cxea2: 2cxe A:9-132 [130997]
    Other proteins in same PDB: d2cxea1, d2cxeb1, d2cxec1, d2cxed1
    automated match to d1ej7l2

Details for d2cxea2

PDB Entry: 2cxe (more details), 3 Å

PDB Description: Crystal structure of octameric ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) from Pyrococcus horikoshii OT3 (form-2 crystal)
PDB Compounds: (A:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d2cxea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cxea2 d.58.9.0 (A:9-132) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
ewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwklpemakrs
makvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppye
ylrh

SCOPe Domain Coordinates for d2cxea2:

Click to download the PDB-style file with coordinates for d2cxea2.
(The format of our PDB-style files is described here.)

Timeline for d2cxea2: