Lineage for d2cxec1 (2cxe C:133-424)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2100572Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2100573Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2100574Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 2100637Species Pyrococcus horikoshii [TaxId:53953] [141850] (3 PDB entries)
    Uniprot O58677 134-424
  8. 2100646Domain d2cxec1: 2cxe C:133-424 [131000]
    Other proteins in same PDB: d2cxea2, d2cxeb2, d2cxec2, d2cxed2

Details for d2cxec1

PDB Entry: 2cxe (more details), 3 Å

PDB Description: Crystal structure of octameric ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) from Pyrococcus horikoshii OT3 (form-2 crystal)
PDB Compounds: (C:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d2cxec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cxec1 c.1.14.1 (C:133-424) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Pyrococcus horikoshii [TaxId: 53953]}
fkgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsggidllkddenft
sfpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraemvaneggqyvmid
ivvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalakaarmigvdqiht
gtavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpelirlfgkdlviqag
ggvmghpdgpragakalrdaidaaiegvdldekaksspelkkslrevglska

SCOPe Domain Coordinates for d2cxec1:

Click to download the PDB-style file with coordinates for d2cxec1.
(The format of our PDB-style files is described here.)

Timeline for d2cxec1: