SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2cx9a1 (2cx9 A:235-387)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992885Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1992886Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 protein domains)
  6. 1992893Protein Acyl-CoA dehydrogenase [140473] (1 species)
  7. 1992894Species Thermus thermophilus [TaxId:274] [140474] (3 PDB entries)
    Uniprot Q5SGZ2 235-387
  8. 1992897Domain d2cx9a1: 2cx9 A:235-387 [130985]
    Other proteins in same PDB: d2cx9a2, d2cx9b2, d2cx9c2, d2cx9d2
    automated match to d1ws9a1
    complexed with cl

Details for d2cx9a1

PDB Entry: 2cx9 (more details), 2 Å

PDB Description: Crystal structure of acyl-CoA dehydrogenase
PDB Compounds: (A:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d2cx9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cx9a1 a.29.3.1 (A:235-387) Acyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]}
gkgfydvlrvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaea
ateleaarllylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdyp
verywrdarltrigegtseilklviarrlleav

SCOPe Domain Coordinates for d2cx9a1:

Click to download the PDB-style file with coordinates for d2cx9a1.
(The format of our PDB-style files is described here.)

Timeline for d2cx9a1: