PDB entry 2cx9

View 2cx9 on RCSB PDB site
Description: Crystal structure of acyl-CoA dehydrogenase
Class: oxidoreductase
Keywords: acyl-CoA dehydrogenase, RSGI, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, OXIDOREDUCTASE
Deposited on 2005-06-28, released 2005-12-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.237
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-CoA dehydrogenase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cx9a1, d2cx9a2
  • Chain 'B':
    Compound: acyl-CoA dehydrogenase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cx9b1, d2cx9b2
  • Chain 'C':
    Compound: acyl-CoA dehydrogenase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cx9c1, d2cx9c2
  • Chain 'D':
    Compound: acyl-CoA dehydrogenase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cx9d1, d2cx9d2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cx9A (A:)
    mglwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpea
    yggaglstrlfarmveaiayydgalaltvashnslatghillagseaqkeaflpklasge
    algawgltepgsgsdaaalktkaekveggwrlngtkqfitqgsvagvyvvmartdpppsp
    erkhqgisafaffrperglkvgrkeeklgltasdtaqliledlfvpeeallgergkgfyd
    vlrvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaeaatelea
    arllylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdypverywr
    darltrigegtseilklviarrlleav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cx9A (A:)
    lwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpeayg
    gaglstrlfarmveaiayydgalaltvashnslatghillagseaqkeaflpklasgeal
    gawgltepgsgsdaaalktkaekveggwrlngtkqfitqgsvagvyvvmartdpppsper
    khqgisafaffrperglkvgrkeeklgltasdtaqliledlfvpeeallgergkgfydvl
    rvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaeaateleaar
    llylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdypverywrda
    rltrigegtseilklviarrlleav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cx9B (B:)
    mglwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpea
    yggaglstrlfarmveaiayydgalaltvashnslatghillagseaqkeaflpklasge
    algawgltepgsgsdaaalktkaekveggwrlngtkqfitqgsvagvyvvmartdpppsp
    erkhqgisafaffrperglkvgrkeeklgltasdtaqliledlfvpeeallgergkgfyd
    vlrvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaeaatelea
    arllylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdypverywr
    darltrigegtseilklviarrlleav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cx9B (B:)
    lwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpeayg
    gaglstrlfarmveaiayydgalaltvashnslatghillagseaqkeaflpklasgeal
    gawgltepgsgsdaaalktkaekveggwrlngtkqfitqgsvagvyvvmartdpppsper
    khqgisafaffrperglkvgrkeeklgltasdtaqliledlfvpeeallgergkgfydvl
    rvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaeaateleaar
    llylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdypverywrda
    rltrigegtseilklviarrlleav
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cx9C (C:)
    mglwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpea
    yggaglstrlfarmveaiayydgalaltvashnslatghillagseaqkeaflpklasge
    algawgltepgsgsdaaalktkaekveggwrlngtkqfitqgsvagvyvvmartdpppsp
    erkhqgisafaffrperglkvgrkeeklgltasdtaqliledlfvpeeallgergkgfyd
    vlrvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaeaatelea
    arllylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdypverywr
    darltrigegtseilklviarrlleav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cx9C (C:)
    lwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpeayg
    gaglstrlfarmveaiayydgalaltvashnslatghillagseaqkeaflpklasgeal
    gawgltepgsgsdaaalktkaekveggwrlngtkqfitqgsvagvyvvmartdpppsper
    khqgisafaffrperglkvgrkeeklgltasdtaqliledlfvpeeallgergkgfydvl
    rvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaeaateleaar
    llylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdypverywrda
    rltrigegtseilklviarrlleav
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2cx9D (D:)
    mglwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpea
    yggaglstrlfarmveaiayydgalaltvashnslatghillagseaqkeaflpklasge
    algawgltepgsgsdaaalktkaekveggwrlngtkqfitqgsvagvyvvmartdpppsp
    erkhqgisafaffrperglkvgrkeeklgltasdtaqliledlfvpeeallgergkgfyd
    vlrvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaeaatelea
    arllylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdypverywr
    darltrigegtseilklviarrlleav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cx9D (D:)
    lwfeegaeerqvlgpfreflkaevapgaaerdrtgafpwdlvrklaefgvfgalvpeayg
    gaglstrlfarmveaiayydgalaltvashnslatghillagseaqkeaflpklasgeal
    gawgltepgsgsdaaalktkaekveggwrlngtkqfitqgsvagvyvvmartdpppsper
    khqgisafaffrperglkvgrkeeklgltasdtaqliledlfvpeeallgergkgfydvl
    rvldggrigiaamavglgqaaldyalayakgreafgrpiaefegvsfklaeaateleaar
    llylkaaelkdagrpftleaaqaklfaseaavkacdeaiqilggygyvkdypverywrda
    rltrigegtseilklviarrlleav