| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.9: Barstar-like [52037] (2 superfamilies) 2 layers, a/b; parallel beta-sheet of 3 strands, order 123 |
Superfamily c.9.1: Barstar-related [52038] (1 family) ![]() |
| Family c.9.1.1: Barstar-related [52039] (2 proteins) |
| Protein Hypothetical protein YhcO [141990] (1 species) |
| Species Escherichia coli [TaxId:562] [141991] (1 PDB entry) |
| Domain d2cx6b1: 2cx6 B:1-90 [130982] automatically matched to 2CX6 A:1-90 |
PDB Entry: 2cx6 (more details), 2.43 Å
SCOP Domain Sequences for d2cx6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cx6b1 c.9.1.1 (B:1-90) Hypothetical protein YhcO {Escherichia coli [TaxId: 562]}
mniytfdfdeiesqedfyrdfsqtfglakdkvrdldslwdvlmndvlplpleiefvhlge
ktrrrfgalillfdeaeeeleghlrfnvrh
Timeline for d2cx6b1: