SCOPe 2.08: Domain d2cx6b_: 2cx6 B:

Lineage for d2cx6b_ (2cx6 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.9: Barstar-like [52037] (2 superfamilies)
   2 layers, a/b; parallel beta-sheet of 3 strands, order 123

4. Superfamily c.9.1: Barstar-related [52038] (1 family)
   automatically mapped to Pfam PF01337

5. Family c.9.1.1: Barstar-related [52039] (3 proteins)

6. Protein Hypothetical protein YhcO [141990] (1 species)

7. Species Escherichia coli [TaxId:562] [141991] (1 PDB entry)
   Uniprot P64618 1-90

8. Domain d2cx6b_: 2cx6 B: [130982]
   automated match to d2cx6a1

Details for d2cx6b_

PDB Entry: 2cx6, 2.43 Å

PDB Description: Crystal structure of ribonuclease inhibitor Barstar

PDB Compounds: (B:) Hypothetical protein yhcO

SCOPe Domain Sequences for d2cx6b_:

Sequence; same for both SEQRES and ATOM records:

>d2cx6b_ c.9.1.1 (B:) Hypothetical protein YhcO {Escherichia coli [TaxId: 562]}
mniytfdfdeiesqedfyrdfsqtfglakdkvrdldslwdvlmndvlplpleiefvhlge
ktrrrfgalillfdeaeeeleghlrfnvrh

Timeline for d2cx6b_:

• d2cx6b_ first appeared in SCOP 1.73, called d2cx6b1
  
• d2cx6b_ appears in SCOPe 2.07