PDB entry 2cx6

View 2cx6 on RCSB PDB site
Description: Crystal structure of ribonuclease inhibitor Barstar
Class: hydrolase inhibitor
Keywords: Barstar, ribonuclease inhibitor, RSGI, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative
Deposited on 2005-06-28, released 2005-12-28
The last revision prior to the SCOP 1.73 freeze date was dated 2005-12-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: 0.229
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yhcO
    Species: Escherichia coli
    Gene: yhcO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64618 (0-89)
      • modified residue (0)
      • modified residue (42)
    Domains in SCOP 1.73: d2cx6a1
  • Chain 'B':
    Compound: Hypothetical protein yhcO
    Species: Escherichia coli
    Gene: yhcO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P64618 (0-89)
      • modified residue (0)
      • modified residue (42)
    Domains in SCOP 1.73: d2cx6b1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cx6A (A:)
    mniytfdfdeiesqedfyrdfsqtfglakdkvrdldslwdvlmndvlplpleiefvhlge
    ktrrrfgalillfdeaeeeleghlrfnvrh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cx6B (B:)
    mniytfdfdeiesqedfyrdfsqtfglakdkvrdldslwdvlmndvlplpleiefvhlge
    ktrrrfgalillfdeaeeeleghlrfnvrh