PDB entry 2cx6

View 2cx6 on RCSB PDB site
Description: Crystal structure of ribonuclease inhibitor Barstar
Class: hydrolase inhibitor
Keywords: Barstar, ribonuclease inhibitor, RSGI, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative
Deposited on 2005-06-28, released 2005-12-28
The last revision prior to the SCOP 1.73 freeze date was dated 2005-12-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: 0.229
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein yhcO
  Species: Escherichia coli
  Gene: yhcO
  Database cross-references and differences (RAF-indexed):
  • Uniprot P64618 (0-89)
    • modified residue (0)
    • modified residue (42)
  Domains in SCOP 1.73: d2cx6a1
• Chain 'B':
  Compound: Hypothetical protein yhcO
  Species: Escherichia coli
  Gene: yhcO
  Database cross-references and differences (RAF-indexed):
  • Uniprot P64618 (0-89)
    • modified residue (0)
    • modified residue (42)
  Domains in SCOP 1.73: d2cx6b1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cx6A (A:)
  mniytfdfdeiesqedfyrdfsqtfglakdkvrdldslwdvlmndvlplpleiefvhlge
  ktrrrfgalillfdeaeeeleghlrfnvrh
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cx6B (B:)
  mniytfdfdeiesqedfyrdfsqtfglakdkvrdldslwdvlmndvlplpleiefvhlge
  ktrrrfgalillfdeaeeeleghlrfnvrh