Lineage for d2cx6a1 (2cx6 A:1-90)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690198Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 690199Superfamily c.9.1: Barstar-related [52038] (1 family) (S)
  5. 690200Family c.9.1.1: Barstar-related [52039] (2 proteins)
  6. 690230Protein Hypothetical protein YhcO [141990] (1 species)
  7. 690231Species Escherichia coli [TaxId:562] [141991] (1 PDB entry)
  8. 690232Domain d2cx6a1: 2cx6 A:1-90 [130981]

Details for d2cx6a1

PDB Entry: 2cx6 (more details), 2.43 Å

PDB Description: Crystal structure of ribonuclease inhibitor Barstar
PDB Compounds: (A:) Hypothetical protein yhcO

SCOP Domain Sequences for d2cx6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cx6a1 c.9.1.1 (A:1-90) Hypothetical protein YhcO {Escherichia coli [TaxId: 562]}
mniytfdfdeiesqedfyrdfsqtfglakdkvrdldslwdvlmndvlplpleiefvhlge
ktrrrfgalillfdeaeeeleghlrfnvrh

SCOP Domain Coordinates for d2cx6a1:

Click to download the PDB-style file with coordinates for d2cx6a1.
(The format of our PDB-style files is described here.)

Timeline for d2cx6a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2cx6b1