Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.9: Barstar-like [52037] (2 superfamilies) 2 layers, a/b; parallel beta-sheet of 3 strands, order 123 |
Superfamily c.9.1: Barstar-related [52038] (1 family) |
Family c.9.1.1: Barstar-related [52039] (2 proteins) |
Protein Hypothetical protein YhcO [141990] (1 species) |
Species Escherichia coli [TaxId:562] [141991] (1 PDB entry) |
Domain d2cx6a1: 2cx6 A:1-90 [130981] |
PDB Entry: 2cx6 (more details), 2.43 Å
SCOP Domain Sequences for d2cx6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cx6a1 c.9.1.1 (A:1-90) Hypothetical protein YhcO {Escherichia coli [TaxId: 562]} mniytfdfdeiesqedfyrdfsqtfglakdkvrdldslwdvlmndvlplpleiefvhlge ktrrrfgalillfdeaeeeleghlrfnvrh
Timeline for d2cx6a1: