Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.3: Manganese catalase (T-catalase) [100951] (2 proteins) automatically mapped to Pfam PF05067 |
Protein automated matches [190575] (2 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [187573] (1 PDB entry) |
Domain d2cwlb_: 2cwl B: [130928] Other proteins in same PDB: d2cwla1 automated match to d2cwla1 |
PDB Entry: 2cwl (more details), 1.65 Å
SCOPe Domain Sequences for d2cwlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cwlb_ a.25.1.3 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mflridrlqielpmpkeqdpnaaaavqallggrfgemstlmnymyqsfnfrgkkalkpyy dlianiateelghielvaatinsllaknpgkdleegvdpesaplgfakdvrnaahfiagg anslvmgamgehwngeyvftsgnlildllhnfflevaarthklrvyemtdnpvaremigy llvrggvhaaaygkalesltgvemtkmlpipkidnskipeakkymdlgfhrnlyrfsped yrdlgliwkgaspedgtevvvvdgpptggpvfdaghdaaefapefhpgelyeiakkly
Timeline for d2cwlb_: