SCOPe 2.08: Domain d2cwlb_: 2cwl B:

Lineage for d2cwlb_ (2cwl B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.3: Manganese catalase (T-catalase) [100951] (2 proteins)
   automatically mapped to Pfam PF05067

6. Protein automated matches [190575] (2 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [187573] (1 PDB entry)

8. Domain d2cwlb_: 2cwl B: [130928]
   Other proteins in same PDB: d2cwla1
   automated match to d2cwla1

Details for d2cwlb_

PDB Entry: 2cwl, 1.65 Å

PDB Description: Crystal structure of manganese-free form of pseudocatalase from Thermus thermophilus HB8

PDB Compounds: (B:) manganese-free pseudocatalase

SCOPe Domain Sequences for d2cwlb_:

Sequence; same for both SEQRES and ATOM records:

>d2cwlb_ a.25.1.3 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mflridrlqielpmpkeqdpnaaaavqallggrfgemstlmnymyqsfnfrgkkalkpyy
dlianiateelghielvaatinsllaknpgkdleegvdpesaplgfakdvrnaahfiagg
anslvmgamgehwngeyvftsgnlildllhnfflevaarthklrvyemtdnpvaremigy
llvrggvhaaaygkalesltgvemtkmlpipkidnskipeakkymdlgfhrnlyrfsped
yrdlgliwkgaspedgtevvvvdgpptggpvfdaghdaaefapefhpgelyeiakkly

Timeline for d2cwlb_:

• d2cwlb_ first appeared in SCOP 1.73, called d2cwlb1
  
• d2cwlb_ appears in SCOPe 2.07