PDB entry 2cwl

View 2cwl on RCSB PDB site
Description: Crystal structure of manganese-free form of pseudocatalase from Thermus thermophilus HB8
Class: oxidoreductase
Keywords: oxidoreductase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-06-21, released 2005-12-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.166
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: manganese-free pseudocatalase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cwla1
  • Chain 'B':
    Compound: manganese-free pseudocatalase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cwlb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cwlA (A:)
    mflridrlqielpmpkeqdpnaaaavqallggrfgemstlmnymyqsfnfrgkkalkpyy
    dlianiateelghielvaatinsllaknpgkdleegvdpesaplgfakdvrnaahfiagg
    anslvmgamgehwngeyvftsgnlildllhnfflevaarthklrvyemtdnpvaremigy
    llvrggvhaaaygkalesltgvemtkmlpipkidnskipeakkymdlgfhrnlyrfsped
    yrdlgliwkgaspedgtevvvvdgpptggpvfdaghdaaefapefhpgelyeiakklyek
    ak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cwlA (A:)
    mflridrlqielpmpkeqdpnaaaavqallggrfgemstlmnymyqsfnfrgkkalkpyy
    dlianiateelghielvaatinsllaknpgkdleegvdpesaplgfakdvrnaahfiagg
    anslvmgamgehwngeyvftsgnlildllhnfflevaarthklrvyemtdnpvaremigy
    llvrggvhaaaygkalesltgvemtkmlpipkidnskipeakkymdlgfhrnlyrfsped
    yrdlgliwkgaspedgtevvvvdgpptggpvfdaghdaaefapefhpgelyeiakklye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cwlB (B:)
    mflridrlqielpmpkeqdpnaaaavqallggrfgemstlmnymyqsfnfrgkkalkpyy
    dlianiateelghielvaatinsllaknpgkdleegvdpesaplgfakdvrnaahfiagg
    anslvmgamgehwngeyvftsgnlildllhnfflevaarthklrvyemtdnpvaremigy
    llvrggvhaaaygkalesltgvemtkmlpipkidnskipeakkymdlgfhrnlyrfsped
    yrdlgliwkgaspedgtevvvvdgpptggpvfdaghdaaefapefhpgelyeiakklyek
    ak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cwlB (B:)
    mflridrlqielpmpkeqdpnaaaavqallggrfgemstlmnymyqsfnfrgkkalkpyy
    dlianiateelghielvaatinsllaknpgkdleegvdpesaplgfakdvrnaahfiagg
    anslvmgamgehwngeyvftsgnlildllhnfflevaarthklrvyemtdnpvaremigy
    llvrggvhaaaygkalesltgvemtkmlpipkidnskipeakkymdlgfhrnlyrfsped
    yrdlgliwkgaspedgtevvvvdgpptggpvfdaghdaaefapefhpgelyeiakkly