Lineage for d2cwla1 (2cwl A:1-299)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703769Family a.25.1.3: Manganese catalase (T-catalase) [100951] (2 proteins)
    automatically mapped to Pfam PF05067
  6. 2703770Protein Manganese catalase (T-catalase) [47263] (2 species)
  7. 2703790Species Thermus thermophilus [TaxId:274] [140444] (1 PDB entry)
    Uniprot Q5SM21 1-299
  8. 2703791Domain d2cwla1: 2cwl A:1-299 [130927]
    Other proteins in same PDB: d2cwlb_

Details for d2cwla1

PDB Entry: 2cwl (more details), 1.65 Å

PDB Description: Crystal structure of manganese-free form of pseudocatalase from Thermus thermophilus HB8
PDB Compounds: (A:) manganese-free pseudocatalase

SCOPe Domain Sequences for d2cwla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwla1 a.25.1.3 (A:1-299) Manganese catalase (T-catalase) {Thermus thermophilus [TaxId: 274]}
mflridrlqielpmpkeqdpnaaaavqallggrfgemstlmnymyqsfnfrgkkalkpyy
dlianiateelghielvaatinsllaknpgkdleegvdpesaplgfakdvrnaahfiagg
anslvmgamgehwngeyvftsgnlildllhnfflevaarthklrvyemtdnpvaremigy
llvrggvhaaaygkalesltgvemtkmlpipkidnskipeakkymdlgfhrnlyrfsped
yrdlgliwkgaspedgtevvvvdgpptggpvfdaghdaaefapefhpgelyeiakklye

SCOPe Domain Coordinates for d2cwla1:

Click to download the PDB-style file with coordinates for d2cwla1.
(The format of our PDB-style files is described here.)

Timeline for d2cwla1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2cwlb_