SCOPe 2.07: Domain d2cwja1: 2cwj A:4-119

Lineage for d2cwja1 (2cwj A:4-119)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (3 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
   some members possess an endoribonuclease activity inhibiting mRNA translation

6. Protein Putative endonuclease APE1501 [143523] (1 species)

7. Species Aeropyrum pernix [TaxId:56636] [143524] (1 PDB entry)
   Uniprot Q9YBU8 4-119

8. Domain d2cwja1: 2cwj A:4-119 [130924]

Details for d2cwja1

PDB Entry: 2cwj, 3.6 Å

PDB Description: crystal structure of ape1501, a putative endonuclease from aeropyrum pernix

PDB Compounds: (A:) putative endonuclease

SCOPe Domain Sequences for d2cwja1:

Sequence; same for both SEQRES and ATOM records:

>d2cwja1 d.79.1.1 (A:4-119) Putative endonuclease APE1501 {Aeropyrum pernix [TaxId: 56636]}
apkpvgpysqavesgcfmfvsgqipinpetgaleeggfkesakraldnlkaivegagysm
ddivkvtvyitdisrfsefnevyreyfnrpyparavvgvaalplgapleveavlyt

Timeline for d2cwja1:

• d2cwja1 first appeared in SCOP 1.73
  
• d2cwja1 appears in SCOPe 2.06
  
• d2cwja1 appears in the current release, SCOPe 2.08