Lineage for d2cwja1 (2cwj A:4-119)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958620Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. 2958694Protein Putative endonuclease APE1501 [143523] (1 species)
  7. 2958695Species Aeropyrum pernix [TaxId:56636] [143524] (1 PDB entry)
    Uniprot Q9YBU8 4-119
  8. 2958696Domain d2cwja1: 2cwj A:4-119 [130924]

Details for d2cwja1

PDB Entry: 2cwj (more details), 3.6 Å

PDB Description: crystal structure of ape1501, a putative endonuclease from aeropyrum pernix
PDB Compounds: (A:) putative endonuclease

SCOPe Domain Sequences for d2cwja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cwja1 d.79.1.1 (A:4-119) Putative endonuclease APE1501 {Aeropyrum pernix [TaxId: 56636]}
apkpvgpysqavesgcfmfvsgqipinpetgaleeggfkesakraldnlkaivegagysm
ddivkvtvyitdisrfsefnevyreyfnrpyparavvgvaalplgapleveavlyt

SCOPe Domain Coordinates for d2cwja1:

Click to download the PDB-style file with coordinates for d2cwja1.
(The format of our PDB-style files is described here.)

Timeline for d2cwja1: